accessibility menu, dialog, popup

UserName
Viewing profile as user:

Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.
All Primary Antibodies (1,707,379)
Primary Antibody Matched Pairs (7,009)
Protein Interaction Antibody Pairs (1,435)
Protein Phosphorylation Antibody Pairs (74)

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Narrow Results

category

special offers

  • (4)
  • (191,788)

brands

  • (1)
  • (1)
  • (29)
  • (2)
  • (2)
  • (973)
  • (67,056)
  • (14,167)
  • (44)
  • (6)
  • (59,913)
  • (1)
  • (110)
  • (266)
  • (2)
  • (1,312)
  • (578)
  • (2)
  • (1)
  • (11)
  • (1)
  • (1)
  • (24)
  • (1)
  • (4)
  • (4)
  • (1)
  • (13)
  • (1)
  • (1)
  • (2)
  • (24)
  • (3)
  • (4)
  • (2)
  • (1)
  • (10,632)
  • (398)
  • (1)
  • (12)
  • (1)
  • (8)
  • (3)
  • (2)
  • (1)
  • (1)
  • (190)
  • (60)
  • (1)
  • (6)
  • (1)
  • (64)
  • (3)
  • (15)
  • (1)
  • (12)
  • (2)
  • (1)
  • (77)
  • (5)
  • (18)
  • (20)
  • (1)
  • (14,089)
  • (2)
  • (1)
  • (1)
  • (31,127)
  • (84)
  • (470)
  • (2)
  • (1)
  • (11,573)
  • (1)
  • (1)
  • (52)
  • (3,054)
  • (6)
  • (470)
  • (105)
  • (22,741)
  • (1)
  • (4,434)
  • (1)
  • (1)
  • (1)
  • (1)
  • (16,786)
  • (1)
  • (76)
  • (18,951)
  • (139)
  • (203)
  • (3)
  • (2)
  • (62)
  • (1)
  • (1)
  • (2)
  • (28)
  • (5)
  • (1)
  • (3)
  • (10)
  • (415)
  • (2)
  • (13,814)
  • (30)
  • (1)
  • (2)
  • (45)
  • (43)
  • (14,698)
  • (1)
  • (2)
  • (8)
  • (6)
  • (2)
  • (20)
  • (2)
  • (2)
  • (55)
  • (1)
  • (2)
  • (12)
  • (20)
  • (1)
  • (34)
  • (2)
  • (1)
  • (41)
  • (2)
  • (1)
  • (62)
  • (53)
  • (487)
  • (56)
  • (10)
  • (3)
  • (80)
  • (12)
  • (11)
  • (1,198)
  • (8)
  • (9)
  • (2)
  • (20)
  • (11)
  • (1)
  • (25)
  • (3)
  • (1)
  • (3)
  • (5)
  • (2)
  • (59)
  • (95)
  • (1)
  • (1)
  • (171)
  • (212)
  • (4)
  • (127)
  • (2)
  • (1)
  • (694)
  • (13)
  • (915)
  • (1)
  • (120)
  • (2,105)
  • (116)
  • (2,514)
  • (1)
  • (12)
  • (1)
  • (1)
  • (978)
  • (1)
  • (1)
  • (1)
  • (2)
  • (6)
  • (123)
  • (1)
  • (3)
  • (2)
  • (3)
  • (1)
  • (1)
  • (8)
  • (1)
  • (302)
  • (1)
  • (1,822)
  • (2)
  • (1)
  • (1,791)
  • (3)
  • (1)
  • (1)
  • (1)
  • (1)
  • (14)
  • (6)
  • (17)
  • (1)
  • (24)
  • (11)
  • (13)
  • (2)
  • (1)
  • (2)
  • (2)
  • (143)
  • (33)
  • (1)
  • (41)
  • (1)
  • (19)
  • (3)
  • (4)
  • (1)
  • (1)
  • (5)
  • (1)
  • (2)
  • (154,297)
  • (4)
  • (54)
  • (2)
  • (3)
  • (3)
  • (133)
  • (1)
  • (1)
  • (11)
  • (1)
  • (118)
  • (1)
  • (2)
  • (4)
  • (198)
  • (1,162)
  • (10)
  • (2)
  • (10)
  • (8)
  • (2)
  • (38)
  • (1)
  • (1)
  • (1)
  • (112)
  • (12,119)
  • (680)
  • (167)
  • (1)
  • (6)
  • (1)
  • (8,397)
  • (1)
  • (3)
  • (16)
  • (4)
  • (137)
  • (31)
  • (116)
  • (1)
  • (3)
  • (8)
  • (6)
  • (9)
  • (3)
  • (2)
  • (1)
  • (1)
  • (1)
  • (2)
  • (1)
  • (2)
  • (1)
  • (1,033,387)
  • (1)
  • (13)
  • (1)
  • (2)
  • (30,493)
  • (13)
  • (1)
  • (32)
  • (1)
  • (1)
  • (6)
  • (79)
  • (1)
  • (1)
  • (11)
  • (7)
  • (1)
  • (2)
  • (1)
  • (1)
  • (1)
  • (2)
  • (23)
  • (35,349)
  • (2)
  • (1)
  • (9)
  • (12,199)
  • (1)
  • (1)
  • (1)
  • (3)
  • (1)
  • (1)
  • (41)
  • (7)
  • (57)
  • (15)
  • (60,251)
  • (1)
  • (5)
  • (17)
  • (4)
  • (1)
  • (30)
  • (549)
  • (1)
  • (12)
  • (2,475)
  • (2)
  • (1)
  • (4)
  • (2)
  • (2)
  • (438)
  • (1)
  • (8)
  • (4)
  • (1)
  • (1)
  • (4)
  • (1)
  • (1,453)
  • (136)
  • (1)
  • (1)
  • (1)
  • (557)
  • (27)
  • (19,477)
  • (1)
  • (6)
  • (1)
  • (1)
  • (1,796)
  • (2)
  • (3)
  • (3)
  • (826)
  • (2)
  • (1)
  • (3)
  • (1)
  • (10)
  • (1)
  • (1)
  • (5)
  • (39)
  • (1)
  • (4)
  • (1)
  • (1)
  • (6)
  • (1)
  • (2)
  • (2,873)
  • (8)
  • (1)
  • (62)
  • (2)
  • (9)
  • (1)
  • (1)
  • (1)
  • (2)
  • (2)
  • (8)
  • (5)
  • (1)
  • (16)
  • (1)
  • (2)
  • (28)
  • (262)
  • (1)
  • (3)
  • (2)
  • (17)
  • (1)
  • (1)
  • (10)
  • (10)
  • (2)
  • (1)
  • (2)
  • (40)
  • (7)

special interests

  • (154)
  • (15,267)
  • (166,580)
  • (30)
  • (1,167,319)

Quantity

  • (1)
  • (7)
  • (2)
  • (3,051)
  • (922)
  • (1,918)
  • (4,393)
Show all

Classification

  • (81)
  • (105)
  • (737,934)
  • (3,641)
  • (5)
  • (688,586)
  • (31,561)
Show all

Host Species

  • (565)
  • (2,694)
  • (38)
  • (1)
  • (15)
  • (1,629)
  • (726)
Show all

Conjugate

  • (29,713)
  • (9)
  • (1)
  • (25)
  • (2,863)
  • (74)
  • (89)
Show all

Applications

  • (435)
  • (2)
  • (36)
  • (23)
  • (169)
  • (830)
  • (3)
Show all

Target Species

  • (59)
  • (55)
  • (34)
  • (94)
  • (135)
  • (5)
  • (665)
Show all

Isotype

  • (2)
  • (1)
  • (2)
  • (1)
  • (1)
  • (1)
  • (6)
Show all

Regulatory Status

  • (336)
  • (962)
  • (1,375,404)

Form

  • (2,701)
  • (2,147)
  • (1,630)
  • (14)
  • (9)
  • (21)
  • (298,390)
Show all

Molecular Weight (g/mol)

  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
Show all

Search Within Results
Keyword Search:
1,216 – 1,230 of 1,636,981 results
1,216

Invitrogen™ nNOS Recombinant Rabbit Monoclonal Antibody (12H5L22)

Rabbit Recombinant Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Form Liquid
Gene Accession No. P29475, P29476, Q9Z0J4
Isotype IgG
Concentration 0.5 mg/mL
Antigen nNOS
Gene Symbols NOS1
Regulatory Status RUO
Purification Method Protein A
Gene Alias 2310005C01Rik; bNOS; bNOS1; Brain NOS; Constitutive NOS; IHPS1; NC-NOS; neuronal nitric oxide synthase; neuronal nitric oxide synthase NOS1; neuronal NOS; nitric oxidase synthase; nitric oxide synthase; nitric oxide synthase 1; nitric oxide synthase 1 (neuronal); nitric oxide synthase 1, neuronal; nitric oxide synthase, brain; nNOS; N-NOS; nNOS; NOS type I; NO; NOS; NOS Type 1; NOS type I; Nos1; Nos-1; NOS-I; Peptidyl-cysteine S-nitrosylase NOS1; Phospho-bNOS; Phospho-Brain NOS
Gene NOS1
Product Type Antibody
Gene ID (Entrez) 18125, 24598, 4842
Formulation PBS with 0.09% sodium azide; pH 7.2-7.4
Immunogen Peptides corresponding to human nNOS [1) aa33-aa50 2) aa348-aa365 3) aa230-aa247].
Classification Recombinant Monoclonal
Primary or Secondary Primary
Clone 12H5L22
1,217

Invitrogen™ CD155 Monoclonal Antibody (2H7CD155), APC, eBioscience™

Mouse Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Human
Host Species Mouse
Conjugate APC
Applications Flow Cytometry
Form Liquid
Gene Accession No. P15151
Isotype IgG1 κ
Concentration 5 μL/Test
Antigen CD155
Gene Symbols PVR
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias 3830421F03Rik; AI325026; AI987993; CD112; CD155; D7Ertd458e; FLJ25946; herpes virus entry mediator B; Herpesvirus entry mediator B; hveB; HVED; mE4; mHveB; Mph; murine herpes virus entry protein B; murine herpesvirus entry protein B; NECL5; necl-5; Nectin cell adhesion molecule 2; Nectin2; Nectin-2; nectin-like 5; nectin-like protein 5; Poliovirus receptor; poliovirus receptor homolog; poliovirus receptor-related 2; poliovirus receptor-related protein 2; poliovirus sensitivity; PVR; Pvrl2; PVS; sCD112; soluble CD112; Taa1; TAGE4; tumor-associated antigen 1; tumor-associated glycoprotein pE4
Gene PVR
Product Type Antibody
Gene ID (Entrez) 5817
Formulation PBS with BSA and 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone 2H7CD155
1,218

CD178 (Fas Ligand) Monoclonal Antibody (MFL3), PE, eBioscience™, Invitrogen™

Armenian Hamster Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Mouse
Host Species Armenian Hamster
Conjugate PE
Applications Flow Cytometry
Form Liquid
Isotype IgG
Gene Accession No. P41047
Concentration 0.2 mg/mL
Antigen CD178 (Fas Ligand)
Gene Symbols Fasl
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Fasl
Product Type Antibody
Gene ID (Entrez) 14103
Classification Monoclonal
Primary or Secondary Primary
Clone MFL3
1,219

Invitrogen™ SSEA4 Monoclonal Antibody (MC-813-70), PE
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE
Content And Storage 4°C, do not freeze
Target Species Human
Host Species Mouse
Conjugate PE
Applications Flow Cytometry
Form Liquid
Isotype IgG3
Concentration 1 mg/mL
Antigen SSEA4
Regulatory Status RUO
Purification Method Protein A
Gene Alias SSEA-4; stage-specific embryonic antigen 4
Product Type Antibody
Formulation PBS with 1mg/mL BSA and 0.05% sodium azide
Immunogen human embryonal carcinoma cell line 2102Ep.
Classification Monoclonal
Primary or Secondary Primary
Clone MC-813-70
1,220

Invitrogen™ GSPT1 Recombinant Rabbit Monoclonal Antibody (HL1345)
GREENER_CHOICE

Rabbit Recombinant Monoclonal Antibody

EDGE
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human,Mouse,Canine
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form Liquid
Gene Accession No. P15170, Q8R050
Isotype IgG
Concentration 1 mg/mL
Antigen GSPT1
Gene Symbols GSPT1
Regulatory Status RUO
Purification Method Protein A
Gene Alias 551G9.2; AI314175; AI326449; AV307676; C79774; ELF; ERF3A; ETF3A; Eukaryotic peptide chain release factor GTP-binding subunit ERF3A; eukaryotic peptide chain release factor subunit 3a; eukaryotic polypeptide chain release factor 3; G1 to phase transition 1; G1 to S phase transition 1; G1 to S phase transition protein 1; G1 to S phase transition protein 1 homolog; G1st; G1-to-S phase transition 1; G1-to-S transition GTP binding protein; GSPT1; GST1; Gst-1; guanine nucleotide regulatory protein
Gene GSPT1
Product Type Antibody
Gene ID (Entrez) 14852, 2935, 479846
Formulation PBS with no preservative
Immunogen Recombinant protein encompassing a sequence within the center region of human GSPT1. The exact sequence is proprietary.
Classification Recombinant Monoclonal
Primary or Secondary Primary
Clone HL1345
1,221

CD33 Monoclonal Antibody (9A11-CD33), APC, eBioscience™, Invitrogen™
GREENER_CHOICE

Rat Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Mouse
Host Species Rat
Conjugate APC
Applications Flow Cytometry
Form Liquid
Isotype IgG1 κ
Gene Accession No. Q63994
Concentration 0.2 mg/mL
Antigen CD33
Gene Symbols CD33
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias CD33; CD33 antigen; CD33 antigen (gp67); CD33 molecule; CD33 molecule transcript; FLJ00391; gp67; Myeloid cell surface antigen CD33; p67; sialic acid binding Ig-like lectin 3; sialic acid-binding Ig-like lectin 3; SIGLEC3; Siglec-3
Gene CD33
Product Type Antibody
Gene ID (Entrez) 12489
Formulation PBS with 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone 9A11-CD33
1,222

Invitrogen™ SCF Recombinant Rabbit Monoclonal Antibody (12H47L56)

Rabbit Recombinant Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Form Liquid
Gene Accession No. P21583
Isotype IgG
Concentration 0.5 mg/mL
Antigen SCF
Gene Symbols KITLG
Regulatory Status RUO
Purification Method Protein A
Gene Alias 710-712; blz; c-Kit ligand; Clo; cloud gray; Con; contrasted; CSF; DCUA; DFNA69; DKFZp686F2250; familial progressive hyperpigmentation 2; FPH2; FPHH; Gb; grizzle-belly; hematopoietic growth factor KL; H-SCF; Kit ligand; Kitl; Kitlg; kit-ligand; KL-1; Mast cell growth factor; MGF; M-SCF; Processed kit ligand; SCF; SF; SHEP7; sKITLG; Sl; SLF; Soluble KIT ligand; Steel factor; steel factor/kit ligand; stem cell factor; stem cell factor KL-1; stem cell factor, CSF
Gene KITLG
Product Type Antibody
Gene ID (Entrez) 4254
Formulation PBS with 0.09% sodium azide; pH 7.2-7.4
Immunogen Peptides corresponding to human SCF [1) aa121-aa139 2) aa28-aa50].
Classification Recombinant Monoclonal
Primary or Secondary Primary
Clone 12H47L56
1,223

CD117 (c-Kit) Monoclonal Antibody (ACK2), Super Bright™ 436, eBioscience™, Invitrogen™
GREENER_CHOICE

Rat Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Mouse
Host Species Rat
Conjugate Super Bright 436
Applications Flow Cytometry
Form Liquid
Isotype IgG2b κ
Gene Accession No. P05532
Concentration 0.2 mg/mL
Antigen CD117 (c-Kit)
Gene Symbols KIT
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias belly-spot; Bs; CD117; ckit; C-Kit; c-KIT gene1; c-kit protein; c-kit proto-oncogene protein; c-kit receptor; c-kit receptor tyrosine kinase; dominant spotting; Dominant white spotting; Fdc; Gsfsco1; Gsfsco5; Gsfsow3; KIT; kit oncogene; KIT proto-oncogene receptor tyrosine kinase; KIT proto-oncogene, receptor tyrosine kinase; mast cell growth factor receptor; mast/stem cell growth factor receptor; mast/stem cell growth factor receptor Kit; MGF; p145 c-kit; PBT; Piebald trait protein; protein kinase; proto-oncogene c-Kit; proto-oncogene tyrosine-protein kinase Kit; receptor tyrosine kinase c-kit; receptor tyrosine kinase type III; SCFR; SCO1; SCO5; Sl; soluble KIT variant 1; SOW3; spotted sterile male; Ssm; Steel Factor Receptor; Tr-kit; tyrosine kinase receptor; tyrosine kinase receptor c-KIT; tyrosine-protein kinase Kit; v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog; v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene-like protein; W
Gene KIT
Product Type Antibody
Gene ID (Entrez) 16590
Formulation PBS with BSA and 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone ACK2
1,224

Invitrogen™ Claudin 7 Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage -20°C
Target Species Human,Mouse,Canine
Host Species Rabbit
Conjugate Unconjugated
Applications ELISA,Immunohistochemistry,Western Blot,Immunocytochemistry
Form Liquid
Gene Accession No. O95471, Q9Z261
Isotype IgG
Concentration 0.25 mg/mL
Antigen Claudin 7
Gene Symbols CLDN7
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias CEPTRL2; claudin 7; claudin-1; Claudin-7; Cldn7; CLDN-7; clostridium perfringens enterotoxin receptor-like 2; CPETRL2; Hs.84359
Gene CLDN7
Product Type Antibody
Gene ID (Entrez) 1366, 489466, 53624
Formulation PBS with 0.1% sodium azide; pH 7.4
Immunogen Synthetic peptide derived from the C-terminal region of the human claudin-7 protein.
Classification Polyclonal
Primary or Secondary Primary
1,225

TDP-43/TARDBP Antibody (2E2-D3), Novus Biologicals™
SDP

Mouse Monoclonal Antibody

EDGE
Content And Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Target Species Human,Mouse,Rat,Bacteria,Insect,Monkey,Firefly
Host Species Mouse
Conjugate Unconjugated
Applications Western Blot,ELISA,Immunohistochemistry,Immunocytochemistry,Immunoprecipitation,Immunohistochemistry (Paraffin),Functional Assay,KnockDown
Form Purified
Isotype IgG1 κ
Gene Accession No. Q13148
Research Discipline Cell Cycle and Replication, Chromatin Research, DNA replication Transcription Translation and Splicing, Epigenetics, Immunology, Mitochondrial Fusion Proteins, Neurodegeneration, Neuronal Cell Markers, Neuroscience, Transcription Factors and Regulators, Virology Bacteria and Parasites
Antigen TDP-43/TARDBP
Regulatory Status RUO
Purification Method IgG purified
Dilution Western Blot 1:500, ELISA 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/ Immunofluorescence 1:10-1:500, Immunoprecipitation 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500, Functional, Knockdown Validated
Gene Alias ALS10TAR DNA-binding protein-43, TAR DNA binding protein, TDP43, TDP-43, TDP-43TAR DNA-binding protein 43
Gene ID (Entrez) 23435
Formulation In 1x PBS, pH 7.4
Classification Monoclonal
Immunogen TARDBP (NP_031401.1, 1 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNA
Primary or Secondary Primary
Clone 2E2-D3
1,226

Invitrogen™ SARS-CoV-2 Spike Protein S1 Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

EDGE
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Virus
Host Species Rabbit
Conjugate Unconjugated
Applications ELISA,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form Liquid
Isotype IgG
Concentration 1 mg/mL
Antigen SARS-CoV-2 Spike Protein S1
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias Coronavirus; COVID; Covid 19; COVID19; COVID-19; SARS; SARS Coronavirus; SARS CoV; SARS CoV2; SARS CoV-2; SARS Spike Protein; SARS-CoV2; SARS-CoV-2
Product Type Antibody
Formulation PBS with 0.02% sodium azide
Immunogen Anti-SARS-CoV-2 (COVID-19) Spike S1 antibody was raised against a peptide corresponding to 16 amino acids near the aminoterminus of SARS-CoV-2 (COVID-19) Spike S1 glycoprotein. The immunogen is located within the first 50 amino acids of SARS-CoV-2 (COVID-19) Spike S1 protein.
Classification Polyclonal
Primary or Secondary Primary
1,227

Invitrogen™ FOXA1 Monoclonal Antibody (3A8)
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE
Content And Storage -20°C
Target Species Human,Mouse,Canine
Host Species Mouse
Conjugate Unconjugated
Applications Immunohistochemistry (Paraffin),Western Blot
Form Liquid
Gene Accession No. P35582, P55317
Isotype IgG
Concentration 1 mg/mL
Antigen FOXA1
Gene Symbols FOXA1
Regulatory Status RUO
Purification Method Protein A
Gene Alias Ci-fkh; fkd7; fkh; fork head domain; forkhead box A1; forkhead box protein A1; forkhead-7; Foxa1; FoxA4a; hepatocyte nuclear factor 3 alpha (winged helix transcription factor); hepatocyte nuclear factor 3, alpha; hepatocyte nuclear factor 3-alpha; HNF3A; HNF-3A; HNF3alpha; HNF-3-alpha; HNF3-alpha; MGC33105; MGC52590; MGC75967; pintallavis; TCF3A; Tcf-3a; tFoxA1; Transcription factor 3A; xfkh1; xfkh2
Gene FOXA1
Product Type Antibody
Gene ID (Entrez) 15375, 3169, 490657
Formulation PBS with 1mg/mL BSA, 30% glycerol and 0.05% sodium azide
Immunogen Recombinant protein expressed in E.coli corresponding to amino acids 1-473 of human FOXA1.
Classification Monoclonal
Primary or Secondary Primary
Clone 3A8
1,228

Invitrogen™ Transferrin Receptor Monoclonal Antibody (MEM-75), PE
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Human
Host Species Mouse
Conjugate PE
Applications Flow Cytometry
Form Liquid
Gene Accession No. P02786
Isotype IgG1 κ
Concentration 0.055 mg/mL
Antigen Transferrin Receptor
Gene Symbols TFRC
Regulatory Status RUO
Purification Method Size-exclusion chromatography
Gene Alias 2610028K12Rik; AI195355; AI426448; AU015758; CD antigen CD71; CD71; chicken transferrin receptor; E430033M20Rik; I79_000642; IMD46; mammary tumor virus receptor 1; Mtvr1; Mtvr-1; p90; sTfR; T9; TfR; tfR1; TFR2; TFRC; TR; transferrin receptor; transferrin receptor (p90, CD71); transferrin receptor 2; transferrin receptor protein 1; Transferrin receptor protein 1, serum form; Trfr
Gene TFRC
Product Type Antibody
Gene ID (Entrez) 7037
Formulation PBS with 0.2% BSA and 15mM sodium azide; pH 7.4
Immunogen Pre-B cell line NALM-6.
Classification Monoclonal
Primary or Secondary Primary
Clone MEM-75
1,229

Invitrogen™ Tyrosine Hydroxylase Recombinant Rabbit Monoclonal Antibody (SN59-03)
GREENER_CHOICE

Rabbit Recombinant Monoclonal Antibody

EDGE
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Flow Cytometry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form Liquid
Gene Accession No. P04177, P07101, P24529
Isotype IgG
Concentration 1 mg/mL
Antigen Tyrosine Hydroxylase
Gene Symbols TH
Regulatory Status RUO
Purification Method Protein A
Gene Alias dystonia 14; DYT14; DYT5b; EC 1.14.16.2; HGNC:11782; Th; TH isoform 3; TH isoform a; th1; TH-4; The; TY3H; TYH; TYH antibody; Tyrosine 3-hydroxylase; tyrosine 3-monooxygenase; tyrosine hydroxylase
Gene TH
Product Type Antibody
Gene ID (Entrez) 21823, 25085, 7054
Formulation TBS with 0.05% BSA, 40% glycerol and 0.05% sodium azide; pH 7.4
Immunogen Synthetic peptide within C-terminal human Tyrosine Hydroxylase.
Classification Recombinant Monoclonal
Primary or Secondary Primary
Clone SN59-03
1,230

Invitrogen™ CD162 (PSGL-1) Monoclonal Antibody (FLEG), PerCP-eFluor™ 710, eBioscience™
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Human
Host Species Mouse
Conjugate PerCP-eFluor 710
Applications Flow Cytometry
Form Liquid
Gene Accession No. Q14242
Isotype IgG2a κ
Concentration 5 μL/Test
Antigen CD162 (PSGL-1)
Gene Symbols SELPLG
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias CD162; CLA; Cutaneous lymphocyte associated antigen; cutaneous lymphocyte-associated associated antigen; leukocyte cell surface adhesion molecule; P-selectin glycoprotein ligand 1; P-selectin glycoprotein ligand 1 propeptide; P-selectin glycoprotein ligand-1; Psgl1; Psgl-1; Selectin P ligand; selectin, platelet (p-selectin) ligand; Selp1; SELPG; Selpl; SELPLG
Gene SELPLG
Product Type Antibody
Gene ID (Entrez) 6404
Formulation PBS with BSA and 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone FLEG